Ver mas grande
NPC2 monoclonal antibody (M01), clone 4B9
AB-H00010577-M01
Producto nuevo
NPC2 monoclonal antibody (M01), clone 4B9
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | NPC2 |
| Gene Alias | HE1|MGC1333|NP-C2 |
| Gene Description | Niemann-Pick disease, type C2 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Tr,WB-Re,ELISA |
| Immunogen Prot. Seq | MRFLAATFLLLALSTAAQAEPVQFKDCGSVDGVIKEVNVSPCPTQPCQLSKGQSYSVNVTFTSNIQSKSSKAVVHGILMGVPVPFPIPEPDGCKSGINCPIQKDKTYSYLNKLPVKSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQIVSHL |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | NPC2 (AAH02532, 1 a.a. ~ 151 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 10577 |
| Clone Number | 4B9 |
| Iso type | IgG2b Kappa |
Más información
Mouse monoclonal antibody raised against a full-length recombinant NPC2.