Ver mas grande
ARIH2 monoclonal antibody (M01A), clone 1C3
AB-H00010425-M01A
Producto nuevo
ARIH2 monoclonal antibody (M01A), clone 1C3
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 200 uL |
| Gene Name | ARIH2 |
| Gene Alias | ARI2|FLJ10938|FLJ33921|TRIAD1 |
| Gene Description | ariadne homolog 2 (Drosophila) |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,ELISA |
| Immunogen Prot. Seq | KTHGSEYYECSRYKENPDIVNQSQQAQAREALKKYLFYFERWENHNKSLQLEAQTYQRIHEKIQERVMNNLGTWIDWQYLQNAAKLLAKC |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | ARIH2 (NP_006312, 331 a.a. ~ 420 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In ascites fluid |
| Gene ID | 10425 |
| Clone Number | 1C3 |
| Iso type | IgM Kappa |
Más información
Mouse monoclonal antibody raised against a partial recombinant ARIH2.