Ver mas grande
Mouse monoclonal antibody raised against a partial recombinant TNFSF15.
AB-H00009966-M09
Producto nuevo
TNFSF15 monoclonal antibody (M09), clone 4F1
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | TNFSF15 |
| Gene Alias | MGC129934|MGC129935|TL1|TL1A|VEGI|VEGI192A |
| Gene Description | tumor necrosis factor (ligand) superfamily, member 15 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,ELISA |
| Immunogen Prot. Seq | LKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | TNFSF15 (AAH74941.1, 72 a.a. ~ 251 a.a) partial recombinant protein. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 9966 |
| Clone Number | 4F1 |
| Iso type | IgG1 Kappa |
Más información
Mouse monoclonal antibody raised against a partial recombinant TNFSF15.