Ver mas grande
SETDB1 monoclonal antibody (M22A), clone 4E8
AB-H00009869-M22A
Producto nuevo
SETDB1 monoclonal antibody (M22A), clone 4E8
No hay Biopuntos para este producto
Hoja técnica
| Size | 200 uL |
| Gene Name | SETDB1 |
| Gene Alias | ESET|KG1T|KIAA0067|KMT1E |
| Gene Description | SET domain, bifurcated 1 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,ELISA |
| Immunogen Prot. Seq | SSLPGCIGLDAATATVESEEIAELQQAVVEELGISMEELRHFIDEELEKMDCVQQRKKQLAELETWVIQKESEVAHVDQLFDDASRAVTNCESLVKDFY |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | SETDB1 (NP_036564, 2 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In ascites fluid |
| Gene ID | 9869 |
| Clone Number | 4E8 |
| Iso type | IgG2a Kappa |
Más información
Mouse monoclonal antibody raised against a partial recombinant SETDB1.