ProSAPiP1 purified MaxPab mouse polyclonal antibody (B01P) Ver mas grande

ProSAPiP1 purified MaxPab mouse polyclonal antibody (B01P)

AB-H00009762-B01P

Producto nuevo

ProSAPiP1 purified MaxPab mouse polyclonal antibody (B01P)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 50 ug
Gene Name ProSAPiP1
Gene Alias KIAA0552
Gene Description ProSAPiP1 protein
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IF
Immunogen Prot. Seq MAKLETLPVRADPGRDPLLAFAPRPSELGPPDPRLAMGSVGSGVAHAQEFAMKSVGTRTGGGGSQGSFPGPRGSGSGASRERPGRYPSEDKGLANSLYLNGELRGSDHTDVCGNVVGSSGGSSSSGGSDKAPPQYREPSHPPKLLATSGKLDQCSEPLVRPSAFKPVVPKNFHSMQNLCPPQTNGTPEGRQGPGGLKGGLDKSRTMTPAGGSGSGLSDSGRNSLTSLPTYSSSYSQHLAPLSASTSHINRIGTAS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ProSAPiP1 (NP_055546.1, 1 a.a. ~ 673 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9762

Más información

Mouse polyclonal antibody raised against a full-length human ProSAPiP1 protein.

Consulta sobre un producto

ProSAPiP1 purified MaxPab mouse polyclonal antibody (B01P)

ProSAPiP1 purified MaxPab mouse polyclonal antibody (B01P)