Ver mas grande
AATK monoclonal antibody (M04A), clone 2C8
AB-H00009625-M04A
Producto nuevo
AATK monoclonal antibody (M04A), clone 2C8
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 200 uL |
| Gene Name | AATK |
| Gene Alias | AATYK|AATYK1|KIAA0641|LMR1|LMTK1|p35BP |
| Gene Description | apoptosis-associated tyrosine kinase |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,WB-Re,ELISA |
| Immunogen Prot. Seq | SPEFVLKEAQEGCEPQAFAELASEGEGPGPETRLSTSLSGLNEKNPYRDSAYFSDLEAEAEATSGPEKKCGGDRAPGPELGLRSTGQPSEQVCLRPGVSG |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | AATK (AAH47378, 161 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In ascites fluid |
| Gene ID | 9625 |
| Clone Number | 2C8 |
| Iso type | IgG1 Kappa |
Más información
Mouse monoclonal antibody raised against a partial recombinant AATK.