Ver mas grande
MAP4K4 monoclonal antibody (M07), clone 4A5
AB-H00009448-M07
Producto nuevo
MAP4K4 monoclonal antibody (M07), clone 4A5
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | MAP4K4 |
| Gene Alias | FLH21957|FLJ10410|FLJ20373|FLJ90111|HGK|KIAA0687|NIK |
| Gene Description | mitogen-activated protein kinase kinase kinase kinase 4 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA |
| Immunogen Prot. Seq | VHPALQRPAEPQVQWSHLASLKNNVSPVSRSHSFSDPSPKFAHHHLRSQDPCPPSRSEVLSQSSDSKSEAPDPTQKAWSRSDSDEVPPRVPVRTTSRSPV |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | MAP4K4 (NP_663719, 611 a.a. ~ 710 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 9448 |
| Clone Number | 4A5 |
| Iso type | IgG1 Kappa |
Más información
Mouse monoclonal antibody raised against a partial recombinant MAP4K4.