Ver mas grande
Mouse monoclonal antibody raised against a full length recombinant PSCD1.
AB-H00009267-M01
Producto nuevo
PSCD1 monoclonal antibody (M01), clone 1D6
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | CYTH1 |
| Gene Alias | B2-1|CYTOHESIN-1|D17S811E|FLJ34050|FLJ41900|PSCD1|SEC7 |
| Gene Description | cytohesin 1 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,IHC-P,S-ELISA,ELISA,IF |
| Immunogen Prot. Seq | MEEDDSYVPSDLTAEERQELENIRRRKQELLADIQRLKDEIAEVANEIENLGSTEERKNMQRNKQVAMGRKKFNMDPKKGIQFLIENDLLKNTCEDIAQFLYKGEGLNKTAIGDYLGERDEFNIQVLHAFVELHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCQCNNGVFQSTDTCYVLSFAIIMLNTSLHNPNVKDKPTVERFIAMNRGINDGGDLPEELLRNLYESIKNEPFKIPEDDGNDLT |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | PSCD1 (AAH50452, 1 a.a. ~ 398 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 9267 |
| Clone Number | 1D6 |
| Iso type | IgG1 kappa |
Más información
Mouse monoclonal antibody raised against a full length recombinant PSCD1.