Ver mas grande
AKAP4 monoclonal antibody (M10), clone 4G1
AB-H00008852-M10
Producto nuevo
AKAP4 monoclonal antibody (M10), clone 4G1
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | AKAP4 |
| Gene Alias | AKAP82|FSC1|HI|hAKAP82|p82 |
| Gene Description | A kinase (PRKA) anchor protein 4 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,WB-Re,ELISA |
| Immunogen Prot. Seq | MMAYSDTTMMSDDIDWLRSHRGVCKVDLYNPEGQQDQDRKVICFVDVSTLNVEDKDYKDAASSSSEGNLNLGSLEEKEIIVIKDTEKKDQSKTEGSVCLF |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | AKAP4 (NP_003877, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 8852 |
| Clone Number | 4G1 |
| Iso type | IgG3 Kappa |
Más información
Mouse monoclonal antibody raised against a partial recombinant AKAP4.