Ver mas grande
CTNNAL1 MaxPab rabbit polyclonal antibody (D01)
AB-H00008727-D01
Producto nuevo
CTNNAL1 MaxPab rabbit polyclonal antibody (D01)
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 uL |
| Gene Name | CTNNAL1 |
| Gene Alias | CLLP|FLJ08121|alpha-CATU |
| Gene Description | catenin (cadherin-associated protein), alpha-like 1 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Tr,IP |
| Immunogen Prot. Seq | MAASPGPAGVGGAGAVYGSGSSGFALDSGLEIKTRSVEQTLLPLVSQITTLINHKDNTKKSDKTLQAIQRVGQAVNLAVGRFVKVGEAIANENWDLKEEINIACIEAKQAGETIAALTDITNLNHLESDGQITIFTDKTGVIKAARLLLSSVTKVLLLADRVVIKQIITSRNKVLATMERLEKVNSFQEFVQIFSQFGNEMVEFAHLSGDRQNDLKDEKKKAKMAAARAVLEKCTMMLLTASKTCLRHPNCESAH |
| Antigen species Target species | Human |
| Quality control testing | Antibody reactive against mammalian transfected lysate. |
| Immunogen | CTNNAL1 (NP_003789.1, 1 a.a. ~ 734 a.a) full-length human protein. |
| Storage Buffer | No additive |
| Gene ID | 8727 |
Más información
Rabbit polyclonal antibody raised against a full-length human CTNNAL1 protein.