Ver mas grande
SLC4A4 polyclonal antibody (A01)
AB-H00008671-A01
Producto nuevo
SLC4A4 polyclonal antibody (A01)
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 50 uL |
| Gene Name | SLC4A4 |
| Gene Alias | DKFZp781H1314|HNBC1|KNBC|NBC1|NBC2|SLC4A5|hhNMC|pNBC |
| Gene Description | solute carrier family 4, sodium bicarbonate cotransporter, member 4 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,ELISA |
| Immunogen Prot. Seq | MEKGSIMLDREASSLPQLVEMIVDHQIETGLLKPELKDKVTYTLLRKHRHQTKKSNLRSLADIGKTVSSASRMFTNPDNGSPAMTHRNLTSSSLNDISDKPEKDQLKNK |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | SLC4A4 (NP_003750, 121 a.a. ~ 229 a.a) partial recombinant protein with GST tag. |
| Storage Buffer | 50 % glycerol |
| Gene ID | 8671 |
Más información
Mouse polyclonal antibody raised against a partial recombinant SLC4A4.