Ver mas grande
GNPAT MaxPab rabbit polyclonal antibody (D01)
AB-H00008443-D01
Producto nuevo
GNPAT MaxPab rabbit polyclonal antibody (D01)
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 uL |
| Gene Name | GNPAT |
| Gene Alias | DAP-AT|DAPAT|DHAPAT |
| Gene Description | glyceronephosphate O-acyltransferase |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Tr,IP,IF |
| Immunogen Prot. Seq | MESSSSSNSYFSVGPTSPSAVVLLYSKELKKWDEFEDILEERRHVSDLKFAMKCYTPLVYKGITPCKPIDIKCSVLNSEEIHYVIKQLSKESLQSVDVLREEVSEILDEMSHKLRLGAIRFCAFTLSKVFKQIFSKVCVNEEGIQKLQRAIQEHPVVLLPSHRSYIDFLMLSFLLYNYDLPVPVIAAGMDFLGMKMVGELLRMSGAFFMRRTFGGNKLYWAVFSEYVKTMLRNGYAPVEFFLEGTRSRSAKTLTP |
| Antigen species Target species | Human |
| Quality control testing | Antibody reactive against mammalian transfected lysate. |
| Immunogen | GNPAT (NP_055051.1, 1 a.a. ~ 680 a.a) full-length human protein. |
| Storage Buffer | No additive |
| Gene ID | 8443 |
Más información
Rabbit polyclonal antibody raised against a full-length human GNPAT protein.