Ver mas grande
TRPV1 monoclonal antibody (M01A), clone 1F5
AB-H00007442-M01A
Producto nuevo
TRPV1 monoclonal antibody (M01A), clone 1F5
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 200 uL |
| Gene Name | TRPV1 |
| Gene Alias | DKFZp434K0220|VR1 |
| Gene Description | transient receptor potential cation channel, subfamily V, member 1 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,ELISA |
| Immunogen Prot. Seq | CPDPLDGDPNSRPPPAKPQLSTAKSRTRLFGKGDSEEAFPVDCPHEEGELDSCPTITVSPVITIQRPGDGPTGARLLSQDSVAASTEKTLRLYDRRSIFEAVAQ |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | TRPV1 (NP_542437, 21 a.a. ~ 124 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In ascites fluid |
| Gene ID | 7442 |
| Clone Number | 1F5 |
| Iso type | IgG1 Kappa |
Más información
Mouse monoclonal antibody raised against a partial recombinant TRPV1.