AB-H00007323-M01
Producto nuevo
Este producto ya no esta disponible
Fecha disponibilidad
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Size | 100 ug |
Gene Name | UBE2D3 |
Gene Alias | E2(17)KB3|MGC43926|MGC5416|UBC4/5|UBCH5C |
Gene Description | ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) |
Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
Application Key | WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA |
Immunogen Prot. Seq | MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM |
Antigen species Target species | Human |
Quality control testing | Antibody Reactive Against Recombinant Protein. |
Immunogen | UBE2D3 (AAH03395, 1 a.a. ~ 147 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Storage Buffer | In 1x PBS, pH 7.4 |
Gene ID | 7323 |
Clone Number | 4C1-1E3 |
Iso type | IgG1 kappa |