Ver mas grande
TLR4 monoclonal antibody (M16), clone 3G12
AB-H00007099-M16
Producto nuevo
TLR4 monoclonal antibody (M16), clone 3G12
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | TLR4 |
| Gene Alias | ARMD10|CD284|TOLL|hToll |
| Gene Description | toll-like receptor 4 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,ELISA |
| Immunogen Prot. Seq | KLVAVETNLASLENFPIGHLKTLKELNVAHNLIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYCTDLRVLHQM |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | TLR4 (NP_612564.1, 130 a.a. ~ 201 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 7099 |
| Clone Number | 3G12 |
| Iso type | IgG2b Kappa |
Más información
Mouse monoclonal antibody raised against a full length recombinant TLR4.