Ver mas grande
NKX2-1 monoclonal antibody (M01), clone 2B9
AB-H00007080-M01
Producto nuevo
NKX2-1 monoclonal antibody (M01), clone 2B9
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | NKX2-1 |
| Gene Alias | BCH|BHC|NK-2|NKX2.1|NKX2A|TEBP|TITF1|TTF-1|TTF1 |
| Gene Description | NK2 homeobox 1 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,ELISA,IF |
| Immunogen Prot. Seq | QLSHSAVGGYCNGNLGNMSELPPYQDTMRNSASGPGWYGANPDPRFPAISRFMGPASGMNMSGMGGLGSLGDVSKNMAPLPS |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | NKX2-1 (NP_003308, 77 a.a. ~ 158 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 7080 |
| Clone Number | 2B9 |
| Iso type | IgG2b Lambda |
Más información
Mouse monoclonal antibody raised against a full-length recombinant NKX2-1.