Ver mas grande
Mouse monoclonal antibody raised against a partial recombinant VAMP1.
AB-H00006843-M01
Producto nuevo
VAMP1 monoclonal antibody (M01), clone 5F3
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | VAMP1 |
| Gene Alias | DKFZp686H12131|SYB1|VAMP-1 |
| Gene Description | vesicle-associated membrane protein 1 (synaptobrevin 1) |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,WB-Re,S-ELISA,ELISA |
| Immunogen Prot. Seq | MTSNRRLQQTQAQVEEVVDIIRVNVDKVLERDQKLSELDDRADALQAGASQFESSAAKLKRKYWWKNCK |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | VAMP1 (NP_055046, 28 a.a. ~ 96 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 6843 |
| Clone Number | 5F3 |
| Iso type | IgG2a Lambda |
Más información
Mouse monoclonal antibody raised against a partial recombinant VAMP1.