Ver mas grande
SLC16A1 purified MaxPab mouse polyclonal antibody (B01P)
AB-H00006566-B01P
Producto nuevo
SLC16A1 purified MaxPab mouse polyclonal antibody (B01P)
No hay Biopuntos para este producto
Hoja técnica
| Size | 50 ug |
| Gene Name | SLC16A1 |
| Gene Alias | FLJ36745|HHF7|MCT|MCT1|MGC44475 |
| Gene Description | solute carrier family 16, member 1 (monocarboxylic acid transporter 1) |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Tr,IF |
| Immunogen Prot. Seq | MPPAVGGPVGYTPPDGGWGWAVVIGAFISIGFSYAFPKSITVFFKEIEGIFHATTSEVSWISSIMLAVMYGGGPISSILVNKYGSRIVMIVGGCLSGCGLIAASFCNTVQQLYVCIGVIGGLGLAFNLNPALTMIGKYFYKRRPLANGLAMAGSPVFLCTLAPLNQVFFGIFGWRGSFLILGGLLLNCCVAGALMRPIGPKPTKAGKDKSKASLEKAGKSGVKKDLHDANTDLIGRHPKQEKRSVFQTINQFLDL |
| Antigen species Target species | Human |
| Quality control testing | Antibody reactive against mammalian transfected lysate. |
| Immunogen | SLC16A1 (P53985, 1 a.a. ~ 500 a.a) full-length human protein. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 6566 |
Más información
Mouse polyclonal antibody raised against a full-length human SLC16A1 protein.