Ver mas grande
SERPINB3 MaxPab rabbit polyclonal antibody (D01)
AB-H00006317-D01
Producto nuevo
SERPINB3 MaxPab rabbit polyclonal antibody (D01)
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 uL |
| Gene Name | SERPINB3 |
| Gene Alias | HsT1196|SCC|SCCA-1|SCCA-PD|SCCA1|T4-A |
| Gene Description | serpin peptidase inhibitor, clade B (ovalbumin), member 3 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Tr,IP |
| Immunogen Prot. Seq | MNSLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTAQQIKKVLHFDQVTENTTGKAATYHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYLFLQEYLDAIKKFYQTSVESVDFANAPEESRKKINSWVESQTNEKIKNLIPEGNIGSNTTLVLVNAIYFKGQWEKKFNKEDTKEEKFWPNKNTYKSIQMMRQYTSFHFASLEDVQAKVLEIPYKGKDLSMIVLLPNEIDGLQ |
| Antigen species Target species | Human |
| Quality control testing | Antibody reactive against mammalian transfected lysate. |
| Immunogen | SERPINB3 (NP_008850.1, 1 a.a. ~ 390 a.a) full-length human protein. |
| Storage Buffer | No additive |
| Gene ID | 6317 |
Más información
Rabbit polyclonal antibody raised against a full-length human SERPINB3 protein.