Ver mas grande
S100A1 polyclonal antibody (A01)
AB-H00006271-A01
Producto nuevo
S100A1 polyclonal antibody (A01)
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 50 uL |
| Gene Name | S100A1 |
| Gene Alias | S100|S100-alpha|S100A |
| Gene Description | S100 calcium binding protein A1 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,ELISA |
| Immunogen Prot. Seq | MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEY |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | S100A1 (NP_006262, 1 a.a. ~ 75 a.a) partial recombinant protein with GST tag. |
| Storage Buffer | 50 % glycerol |
| Gene ID | 6271 |
Más información
Mouse polyclonal antibody raised against a partial recombinant S100A1.