AB-H00006197-A01
Producto nuevo
Este producto ya no esta disponible
Fecha disponibilidad
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Size | 50 uL |
Gene Name | RPS6KA3 |
Gene Alias | CLS|HU-3|ISPK-1|MAPKAPK1B|MRX19|RSK|RSK2|S6K-alpha3|p90-RSK2|pp90RSK2 |
Gene Description | ribosomal protein S6 kinase, 90kDa, polypeptide 3 |
Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
Application Key | WB-Ce,WB-Re,ELISA |
Immunogen Prot. Seq | PLAQLADPWQKMAVESPSDSAENGQQIMDEPMGEEEINPQTEEVSIKEIAITHHVKEGHEKADPSQFELLKVLGQGSFGKVFLVKKISGSDARQ |
Antigen species Target species | Human |
Quality control testing | Antibody Reactive Against Recombinant Protein. |
Immunogen | RPS6KA3 (NP_004577, 2 a.a. ~ 95 a.a) partial recombinant protein with GST tag. |
Storage Buffer | 50 % glycerol |
Gene ID | 6197 |