Ver mas grande
RARRES3 monoclonal antibody (M10), clone 1H5
AB-H00005920-M10
Producto nuevo
RARRES3 monoclonal antibody (M10), clone 1H5
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | RARRES3 |
| Gene Alias | HRASLS4|MGC8906|RIG1|TIG3 |
| Gene Description | retinoic acid receptor responder (tazarotene induced) 3 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Tr,ELISA |
| Immunogen Prot. Seq | MASPHQEPKPGDLIEIFRLGYEHWALYIGDGYVIHLAPPSEYPGAGSSSVFSVLSNSAEVKRERLEDVVGGCCYRVNNSLDHEYQPRPVEVIISSAKEMVGQKMKYSIVSRNCEHFVTQLRYGKSRCKQVEKAKVEVGVATALGILVVAGCSFAIRRYQKKATA |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | RARRES3 (AAH09678, 1 a.a. ~ 164 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 5920 |
| Clone Number | 1H5 |
| Iso type | IgG2a Kappa |
Más información
Mouse monoclonal antibody raised against a full-length recombinant RARRES3.