Ver mas grande
RAB3A polyclonal antibody (A03)
AB-H00005864-A03
Producto nuevo
RAB3A polyclonal antibody (A03)
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 50 uL |
| Gene Name | RAB3A |
| Gene Alias | - |
| Gene Description | RAB3A, member RAS oncogene family |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,ELISA |
| Immunogen Prot. Seq | TYSWDNAQVLLVGNKCDMEDERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLSDQQVPPHQDCAC |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | RAB3A (NP_002857, 122 a.a. ~ 220 a.a) partial recombinant protein with GST tag. |
| Storage Buffer | 50 % glycerol |
| Gene ID | 5864 |
Más información
Mouse polyclonal antibody raised against a partial recombinant RAB3A.