Ver mas grande
PRKCD monoclonal antibody (M06), clone 2E12
AB-H00005580-M06
Producto nuevo
PRKCD monoclonal antibody (M06), clone 2E12
No hay Biopuntos para este producto
Hoja técnica
| Size | 100 ug |
| Gene Name | PRKCD |
| Gene Alias | MAY1|MGC49908|PKCD|nPKC-delta |
| Gene Description | protein kinase C, delta |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,S-ELISA,ELISA,IF |
| Immunogen Prot. Seq | DILEKLFEREPTKRLGVTGNIKIHPFFKTINWTLLEKRRLEPPFRPKVKSPRDYSNFDQEFLNEKARLSYSDKNLIDSMDQSAFAGFSFVNPKFEHLLED |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | PRKCD (NP_006245, 577 a.a. ~ 676 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 5580 |
| Clone Number | 2E12 |
| Iso type | IgG2a Kappa |
Más información
Mouse monoclonal antibody raised against a partial recombinant PRKCD.