Ver mas grande
PRKACA monoclonal antibody (M01A), clone 1C4
AB-H00005566-M01A
Producto nuevo
PRKACA monoclonal antibody (M01A), clone 1C4
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 200 uL |
| Gene Name | PRKACA |
| Gene Alias | MGC102831|MGC48865|PKACA |
| Gene Description | protein kinase, cAMP-dependent, catalytic, alpha |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,ELISA |
| Immunogen Prot. Seq | MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMV |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | PRKACA (AAH39846, 1 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In ascites fluid |
| Gene ID | 5566 |
| Clone Number | 1C4 |
| Iso type | IgG Mix Kappa |
Más información
Mouse monoclonal antibody raised against a partial recombinant PRKACA.