PPIA polyclonal antibody (A01) Ver mas grande

PPIA polyclonal antibody (A01)

AB-H00005478-A01

Producto nuevo

PPIA polyclonal antibody (A01)

Más detalles

Por favor regístrese para ver el precio

No hay Biopuntos para este producto


Hoja técnica

Size 50 uL
Gene Name PPIA
Gene Alias CYPA|CYPH|MGC117158|MGC12404|MGC23397
Gene Description peptidylprolyl isomerase A (cyclophilin A)
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PPIA (AAH00689.1, 1 a.a. ~ 165 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5478

Más información

Mouse polyclonal antibody raised against a full-length recombinant PPIA.

Consulta sobre un producto

PPIA polyclonal antibody (A01)

PPIA polyclonal antibody (A01)