Ver mas grande
PAK3 monoclonal antibody (M08), clone 3A12
AB-H00005063-M08
Producto nuevo
PAK3 monoclonal antibody (M08), clone 3A12
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | PAK3 |
| Gene Alias | CDKN1A|MRX30|MRX47|OPHN3|PAK3beta|bPAK|hPAK3 |
| Gene Description | p21 protein (Cdc42/Rac)-activated kinase 3 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,WB-Re,ELISA,IF |
| Immunogen Prot. Seq | MSDGLDNEEKPPAPPLRMNSNNRDSSALNHSSKPLPMAPEEKNKKARLRSIFPGGGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGE |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | PAK3 (NP_002569, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 5063 |
| Clone Number | 3A12 |
| Iso type | IgG2a Kappa |
Más información
Mouse monoclonal antibody raised against a partial recombinant PAK3.