Ver mas grande
NME2 monoclonal antibody (M01A), clone S1
AB-H00004831-M01A
Producto nuevo
NME2 monoclonal antibody (M01A), clone S1
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 200 uL |
| Gene Name | NME2 |
| Gene Alias | MGC111212|NDPK-B|NDPKB|NM23-H2|NM23B|puf |
| Gene Description | non-metastatic cells 2, protein (NM23B) expressed in |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,WB-Re,ELISA |
| Immunogen Prot. Seq | MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | NME2 (AAH02476, 1 a.a. ~ 152 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In ascites fluid |
| Gene ID | 4831 |
| Clone Number | S1 |
| Iso type | IgG1 Kappa |
Más información
Mouse monoclonal antibody raised against a full-length recombinant NME2.