Ver mas grande
NEDD9 monoclonal antibody (M01), clone 1B4
AB-H00004739-M01
Producto nuevo
NEDD9 monoclonal antibody (M01), clone 1B4
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 50 ug |
| Gene Name | NEDD9 |
| Gene Alias | CAS-L|CAS2|CASL|CASS2|HEF1|dJ49G10.2|dJ761I2.1 |
| Gene Description | neural precursor cell expressed, developmentally down-regulated 9 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Tr,WB-Re,ELISA,IF |
| Immunogen Prot. Seq | PRDTIYQVPPSYQNQGIYQVPTGHGTQEQEVYQVPPSVQRSIGGTSGPHVGKKVITPVRTGHGYVYEYPSRYQKDVYDIPPSHTTQGVYDIPPSSAKGPV |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | NEDD9 (NP_006394, 101 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 4739 |
| Clone Number | 1B4 |
| Iso type | IgG1 Kappa |
Más información
Mouse monoclonal antibody raised against a partial recombinant NEDD9.