Ver mas grande
NDUFB7 purified MaxPab mouse polyclonal antibody (B01P)
AB-H00004713-B01P
Producto nuevo
NDUFB7 purified MaxPab mouse polyclonal antibody (B01P)
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 50 ug |
| Gene Name | NDUFB7 |
| Gene Alias | B18|CI-B18|MGC2480 |
| Gene Description | NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 7, 18kDa |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,WB-Tr |
| Immunogen Prot. Seq | MGAHLVRRYLGDASVEPDPLQMPTFPPDYGFPERKEREMVATQQEMMDAQLRLQLRDYCAHHLIRLLKCKRDSFPNFLACKQERHDWDYCEHRDYVMRMKEFERERRLLQRKKRREKKAAELAKGQGPGEVDPKVAL |
| Antigen species Target species | Human |
| Quality control testing | Antibody reactive against mammalian transfected lysate. |
| Immunogen | NDUFB7 (NP_004137.2, 1 a.a. ~ 137 a.a) full-length human protein. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 4713 |
Más información
Mouse polyclonal antibody raised against a full-length human NDUFB7 protein.