Ver mas grande
ABCC1 monoclonal antibody (M01), clone 1G8
AB-H00004363-M01
Producto nuevo
ABCC1 monoclonal antibody (M01), clone 1G8
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | ABCC1 |
| Gene Alias | ABC29|ABCC|DKFZp686N04233|DKFZp781G125|GS-X|MRP|MRP1 |
| Gene Description | ATP-binding cassette, sub-family C (CFTR/MRP), member 1 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,ELISA |
| Immunogen Prot. Seq | MLKNKTRILVTHSMSYLPQVDVIIVMSGGKISEMGSYQELLARDGAFAEFLRTYASTEQEQDAEENGVTGVSGPGKEAKQMENGMLVTDSAGKQLQRQLS |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | ABCC1 (NP_004987, 816 a.a. ~ 915 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 4363 |
| Clone Number | 1G8 |
| Iso type | IgG1 Kappa |
Más información
Mouse monoclonal antibody raised against a partial recombinant ABCC1.