SMAD7 polyclonal antibody (A01) Ver mas grande

SMAD7 polyclonal antibody (A01)

AB-H00004092-A01

Producto nuevo

SMAD7 polyclonal antibody (A01)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Hoja técnica

Size 50 uL
Gene Name SMAD7
Gene Alias CRCS3|FLJ16482|MADH7|MADH8
Gene Description SMAD family member 7
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq CKVFRWPDLRHSSEVKRLCCCESYGKINPELVCCNPHHLSRLCELESPPPPYSRYPMDFLKPTADCPDAVPSSAETGGTNYLAPGGLSDSQLLLEPGDRSH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SMAD7 (NP_005895, 160 a.a. ~ 260 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4092

Más información

Mouse polyclonal antibody raised against a partial recombinant SMAD7.

Consulta sobre un producto

SMAD7 polyclonal antibody (A01)

SMAD7 polyclonal antibody (A01)