AB-H00004087-M01
Producto nuevo
Este producto ya no esta disponible
Fecha disponibilidad
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Size | 100 ug |
Gene Name | SMAD2 |
Gene Alias | JV18|JV18-1|MADH2|MADR2|MGC22139|MGC34440|hMAD-2|hSMAD2 |
Gene Description | SMAD family member 2 |
Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
Application Key | WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA,IF |
Immunogen Prot. Seq | PRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQSMDTGSPAELSPTTLSPVNHSLDLQPVTYSEPAFWCSIAYY |
Antigen species Target species | Human |
Quality control testing | Antibody Reactive Against Recombinant Protein. |
Immunogen | SMAD2 (AAH25699, 181 a.a. ~ 280 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Storage Buffer | In 1x PBS, pH 7.4 |
Gene ID | 4087 |
Clone Number | 4D10 |
Iso type | IgG2a Kappa |