Ver mas grande
KHK monoclonal antibody (M01), clone 1H6-2B6
AB-H00003795-M01
Producto nuevo
KHK monoclonal antibody (M01), clone 1H6-2B6
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | KHK |
| Gene Alias | - |
| Gene Description | ketohexokinase (fructokinase) |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ti,WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA,RNAi-Ab |
| Immunogen Prot. Seq | MEEKQILCVGLVVLDVISLVDKYPKEDSEIRCLSQRWQRGGNASNSCTILSLLGAPCAFMGSMAPGHVADFVLDDLRRYSVDLRYTVFQTTGSVPIATVIINEASGSRTILYYDRSLPDVSATDFEKVDLTQFKWIHIEGRNASEQVKMLQRIDAHNTRQPPEQKIRVSVEVEKPREELFQLFGYGDVVFVSKDVAKHLGFQSAEEALRGLYGRVRKGAVLVCAWAEEGADALGPDGKLLHSDAFPPPRVVDTLG |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | KHK (AAH06233, 1 a.a. ~ 298 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 3795 |
| Clone Number | 1H6-2B6 |
| Iso type | IgG2a kappa |
Más información
Mouse monoclonal antibody raised against a full length recombinant KHK.