Ver mas grande
IL6 purified MaxPab mouse polyclonal antibody (B02P)
AB-H00003569-B02P
Producto nuevo
IL6 purified MaxPab mouse polyclonal antibody (B02P)
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 50 ug |
| Gene Name | IL6 |
| Gene Alias | BSF2|HGF|HSF|IFNB2|IL-6 |
| Gene Description | interleukin 6 (interferon, beta 2) |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Tr |
| Immunogen Prot. Seq | MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM |
| Antigen species Target species | Human |
| Quality control testing | Antibody reactive against mammalian transfected lysate. |
| Immunogen | IL6 (AAH15511.1, 1 a.a. ~ 212 a.a) full-length human protein. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 3569 |
Más información
Mouse polyclonal antibody raised against a full-length human IL6 protein.