Ver mas grande
IL3RA polyclonal antibody (A01)
AB-H00003563-A01
Producto nuevo
IL3RA polyclonal antibody (A01)
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 50 uL |
| Gene Name | IL3RA |
| Gene Alias | CD123|IL3R|IL3RAY|IL3RX|IL3RY|MGC34174|hIL-3Ra |
| Gene Description | interleukin 3 receptor, alpha (low affinity) |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,ELISA |
| Immunogen Prot. Seq | TKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAEN |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | IL3RA (NP_002174, 19 a.a. ~ 109 a.a) partial recombinant protein with GST tag. |
| Storage Buffer | 50 % glycerol |
| Gene ID | 3563 |
Más información
Mouse polyclonal antibody raised against a partial recombinant IL3RA.