RBPJ monoclonal antibody (M01), clone 4E12 Ver mas grande

RBPJ monoclonal antibody (M01), clone 4E12

AB-H00003516-M01

Producto nuevo

RBPJ monoclonal antibody (M01), clone 4E12

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 50 ug
Gene Name RBPJ
Gene Alias CBF1|IGKJRB|IGKJRB1|KBF2|MGC61669|RBP-J|RBPJK|RBPSUH|SUH|csl
Gene Description recombination signal binding protein for immunoglobulin kappa J region
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq WIKRKFGERPPPKRLTREAMRNYLKERGDQTVLILHAKVAQKSYGNEKRFFCPPPCVYLMGSGWKKKKEQMERDGCSEQESQPCAFIGIGNSDQEMQQLNLEGKNYC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RBPJ (NP_976029, 3 a.a. ~ 109 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3516
Clone Number 4E12
Iso type IgG2b Kappa

Más información

Mouse monoclonal antibody raised against a partial recombinant RBPJ.

Consulta sobre un producto

RBPJ monoclonal antibody (M01), clone 4E12

RBPJ monoclonal antibody (M01), clone 4E12