Ver mas grande
FOXA3 MaxPab rabbit polyclonal antibody (D01)
AB-H00003171-D01
Producto nuevo
FOXA3 MaxPab rabbit polyclonal antibody (D01)
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 uL |
| Gene Name | FOXA3 |
| Gene Alias | FKHH3|HNF3G|MGC10179|TCF3G |
| Gene Description | forkhead box A3 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | IP |
| Immunogen Prot. Seq | MLGSVKMEAHDLAEWSYYPEAGEVYSPVTPVPTMAPLNSYMTLNPLSSPYPPGGLPASPLPSGPLAPPAPAAPLGPTFPGLGVSGGSSSSGYGAPGPGLVHGKEMPKGYRRPLAHAKPPYSYISLITMAIQQAPGKMLTLSEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWALHPSSGNMFENGCYLRRQKRFKLEEKVKKGGSGAATTTRNGTGSAASTTTPAATVTSPPQPPP |
| Antigen species Target species | Human |
| Quality control testing | Antibody reactive against mammalian transfected lysate. |
| Immunogen | FOXA3 (NP_004488.2, 1 a.a. ~ 350 a.a) full-length human protein. |
| Storage Buffer | No additive |
| Gene ID | 3171 |
Más información
Rabbit polyclonal antibody raised against a full-length human FOXA3 protein.