Ver mas grande
GCH1 monoclonal antibody (M01), clone 4A12
AB-H00002643-M01
Producto nuevo
GCH1 monoclonal antibody (M01), clone 4A12
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | GCH1 |
| Gene Alias | DYT14|DYT5|GCH|GTP-CH-1|GTPCH1 |
| Gene Description | GTP cyclohydrolase 1 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,WB-Tr,WB-Re,IHC-P,IP,S-ELISA,ELISA |
| Immunogen Prot. Seq | ENPQRQGLLKTPWRAASAMQFFTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNKQVLGLSKLARIV |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | GCH1 (NP_000152, 84 a.a. ~ 172 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 2643 |
| Clone Number | 4A12 |
| Iso type | IgG2a Kappa |
Más información
Mouse monoclonal antibody raised against a partial recombinant GCH1.