Ver mas grande
FUCA1 polyclonal antibody (A01)
AB-H00002517-A01
Producto nuevo
FUCA1 polyclonal antibody (A01)
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 50 uL |
| Gene Name | FUCA1 |
| Gene Alias | FUCA |
| Gene Description | fucosidase, alpha-L- 1, tissue |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,ELISA |
| Immunogen Prot. Seq | EAIYASKPWRVQWEKNITSVWYTSKGSAVYAIFLHWPENGVLNLESPITTSTTKITMLGIQGDLKWSTDPDKGLFISLPQLPPSAVPAEFAWTIKLTGVK |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | FUCA1 (NP_000138, 362 a.a. ~ 461 a.a) partial recombinant protein with GST tag. |
| Storage Buffer | 50 % glycerol |
| Gene ID | 2517 |
Más información
Mouse polyclonal antibody raised against a partial recombinant FUCA1.