Ver mas grande
FOSL2 monoclonal antibody (M01), clone 2B4-1C2
AB-H00002355-M01
Producto nuevo
FOSL2 monoclonal antibody (M01), clone 2B4-1C2
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | FOSL2 |
| Gene Alias | FLJ23306|FRA2 |
| Gene Description | FOS-like antigen 2 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,WB-Re,S-ELISA,ELISA,IF |
| Immunogen Prot. Seq | MSVGLDLPQMLPGSPSPSLKEAFAEDGEAGEGGGRPSLEWRLQQLLPQHPLSLSWLLTSPQGTGPFLPSVVICHLLDQVLSLLHSPVPTPVHSSGPGSKQAVNSWPELSLWLVAHAPFLVVC |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | FOSL2 (AAH08899, 1 a.a. ~ 122 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 2355 |
| Clone Number | 2B4-1C2 |
| Iso type | IgG2b Kappa |
Más información
Mouse monoclonal antibody raised against a full length recombinant FOSL2.