AB-H00002071-A01
Producto nuevo
Este producto ya no esta disponible
Fecha disponibilidad
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Size | 50 uL |
Gene Name | ERCC3 |
Gene Alias | BTF2|GTF2H|RAD25|TFIIH|XPB |
Gene Description | excision repair cross-complementing rodent repair deficiency, complementation group 3 (xeroderma pigmentosum group B complementing) |
Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
Application Key | WB-Re,ELISA |
Immunogen Prot. Seq | APGNDPQEAVPSAAGKQVDESGTKVDEYGAKDYRLQMPLKDDHTSRPLWVAPDGHIFLEAFSPVYKYAQDFLVAIAEPVCRPTHVHEYKLTAYSLYAAVS |
Antigen species Target species | Human |
Quality control testing | Antibody Reactive Against Recombinant Protein. |
Immunogen | ERCC3 (AAH08820, 29 a.a. ~ 128 a.a) partial recombinant protein with GST tag. |
Storage Buffer | 50 % glycerol |
Gene ID | 2071 |