Ver mas grande
CSRP2 polyclonal antibody (A01)
AB-H00001466-A01
Producto nuevo
CSRP2 polyclonal antibody (A01)
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 50 uL |
| Gene Name | CSRP2 |
| Gene Alias | CRP2|LMO5|SmLIM |
| Gene Description | cysteine and glycine-rich protein 2 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,ELISA |
| Immunogen Prot. Seq | MPVWGGGNKCGACGRTVYHAEEVQCDGRSFHRCCFLCMVCRKNLDSTTVAIHDEEIYCKSCYGKKYGPKGYGYGQGAGTLNMDRGERLGIKPESVQPHRPTTNPNTSKFAQKYGGAEKCSRCGDSVYAAEKIIGAGKPWHKNCFRCAKCGKSLESTTLTEKEGEIYCKGCYAKNFGPKGFGYGQGAGALVHAQ |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | CSRP2 (AAH00992, 1 a.a. ~ 193 a.a) full-length recombinant protein with GST tag. |
| Storage Buffer | 50 % glycerol |
| Gene ID | 1466 |
Más información
Mouse polyclonal antibody raised against a full-length recombinant CSRP2.