Ver mas grande
CLTC monoclonal antibody (M05), clone 2E5
AB-H00001213-M05
Producto nuevo
CLTC monoclonal antibody (M05), clone 2E5
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 50 ug |
| Gene Name | CLTC |
| Gene Alias | CHC|CHC17|CLH-17|CLTCL2|Hc|KIAA0034 |
| Gene Description | clathrin, heavy chain (Hc) |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,S-ELISA,ELISA,PLA-Ce |
| Immunogen Prot. Seq | EVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITN |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | CLTC (NP_004850, 232 a.a. ~ 340 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 1213 |
| Clone Number | 2E5 |
| Iso type | IgG2a Kappa |
Más información
Mouse monoclonal antibody raised against a partial recombinant CLTC.