Ver mas grande
CHRNA5 monoclonal antibody (M01), clone 7D3
AB-H00001138-M01
Producto nuevo
CHRNA5 monoclonal antibody (M01), clone 7D3
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | CHRNA5 |
| Gene Alias | LNCR2 |
| Gene Description | cholinergic receptor, nicotinic, alpha 5 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Tr,WB-Re,S-ELISA,ELISA |
| Immunogen Prot. Seq | SEPSSIAKHEDSLLKDLFQDYERWVRPVEHLNDKIKIKFGLAISQLVDVDEKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKVIRVPSDSVWTP |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | CHRNA5 (NP_000736, 38 a.a. ~ 131 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 1138 |
| Clone Number | 7D3 |
| Iso type | IgG1 Kappa |
Más información
Mouse monoclonal antibody raised against a partial recombinant CHRNA5.