Ver mas grande
CD59 purified MaxPab mouse polyclonal antibody (B02P)
AB-H00000966-B02P
Producto nuevo
CD59 purified MaxPab mouse polyclonal antibody (B02P)
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 50 ug |
| Gene Name | CD59 |
| Gene Alias | 16.3A5|1F5|EJ16|EJ30|EL32|FLJ38134|FLJ92039|G344|HRF-20|HRF20|MAC-IP|MACIF|MEM43|MGC2354|MIC11|MIN1|MIN2|MIN3|MIRL|MSK21|p18-20 |
| Gene Description | CD59 molecule, complement regulatory protein |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Tr |
| Immunogen Prot. Seq | MGIQGGSVLFGLLLVLAVFCHSGHSLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGGTSLSEKTVLLLVTPFLAAAWSLHP |
| Antigen species Target species | Human |
| Quality control testing | Antibody reactive against mammalian transfected lysate. |
| Immunogen | CD59 (NP_000602.1, 1 a.a. ~ 128 a.a) full-length human protein. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 966 |
Más información
Mouse polyclonal antibody raised against a full-length human CD59 protein.