Ver mas grande
BUB1 monoclonal antibody (M02), clone 2F9
AB-H00000699-M02
Producto nuevo
BUB1 monoclonal antibody (M02), clone 2F9
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | BUB1 |
| Gene Alias | BUB1A|BUB1L|hBUB1 |
| Gene Description | budding uninhibited by benzimidazoles 1 homolog (yeast) |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,WB-Tr,WB-Re,IP,S-ELISA,ELISA |
| Immunogen Prot. Seq | MDTPENVLQMLEAHMQSYKGNDPLGEWERYIQWVEENFPENKEYLITLLEHLMKEFLDKKKYHNDPRFISYCLKFAEYNSDLHQFFEFLYNHGIGTLSSPLYIAWAGHLEAQGELQHASAVLQRGIQNQA |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | BUB1 (AAH28201, 1 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 699 |
| Clone Number | 2F9 |
| Iso type | IgG1 Kappa |
Más información
Mouse monoclonal antibody raised against a partial recombinant BUB1.